All cas no 111 76 2 wholesalers & cas no 111 76 2 manufacturers come from members. We doesn't provide cas no 111 76 2 products or service, please contact them directly and verify their companies info carefully.
Total 1196 products from cas no 111 76 2 Manufactures & Suppliers |
|
Brand Name:TIMKEN / NSK / NTN / FSKG / KBE / OEM Model Number:T441 Place of Origin:CHINA ...111.76*223.52*55.88mm Brass Cage Bearing Specification : FSK BEARING Model Number T441 Part Name Thrust Tapered Roller Bearing Application Tower Crane/Rolling Mill/Oil Drilling Material Gcr15 Chrome steel Cage Brass Cage Row Single Row Brand TIMKEN / NSK / NTN / FSKG / KBE / OEM Precision Rating ABEC-3 / ABEC-5 Dimensions(mm)(d*D*b) 111.76... |
Wuxi FSK Transmission Bearing Co., Ltd
Jiangsu |
Place of Origin:China Brand Name:Chinafoodpharm Raspberry ketone CAS No.: 84929-76-0 Appearance: white powder Variety: raspberry extract Extract Method: Water/ Grain Alcohol Specification:99% ABOUT Raspberry Ketones: ... |
China Foodpharm Group Co., Ltd
Anhui |
Brand Name:Zhanjo Model Number:ZJ-257 Place of Origin:China English name]: Arbutin [CAS NO.]: 497-76-7 [Formula]: C12H16O7 [Molecular Weight]: 272.25 [Structural Formula]: [Specification]: 98% [Test method]: HPLC [Product properties]: ... |
Anhui Zhanjo Natural Product Co.,ltd
Anhui |
Brand Name:Honorshine Chem Place of Origin:China WuXi INDENYLZIRCONIUM(IV) TRICHLORIDE Product code:INDENYLZIRCONIUM(IV) TRICHLORIDE CAS No.:82161-76-0 Molecular formula: C9H7Cl3Zr Molecular Weight: 312.73 Materialized properties: Melting Point: 151-161°c In Stock : Available / Available on request Supply ... |
WUXI HONOR SHINE CHEMICAL CO.,LTD
Jiangsu |
Brand Name:BBP Model Number:BBP-ARBUTIN-01 Place of Origin:CHINA CAS No. 497-76-7 Beta Arbutin with 99% Purity for Skin Whiten Cosmetic Products Beyond Bionherbal is a professional manufacturer and supplier of Beta Arbutin. The appearance of Beta Arbutin is white crystal Powder and it is Easily soluble in hot water and ... |
Beyond Bioherbal Co.,ltd.
Shanghai |
Brand Name:Olopatadine hydrochloride Model Number:CAS NO.:140462-76-6 Place of Origin:. Name :Olopatadine hydrochloride Synonyms :(Z)-11-[3-(Dimethylamino)propylidene]-6,11-dihydrodibenz[b,e]oxepin-2-acetic acid hydrochloride Molecular Formula : C21H23NO3.HCl Molecular Weight :373.88 CAS NO.: 140462-76-6 |
Suzhou Howsine Biological Technology Co.,Ltd
Jiangsu |
Brand Name:YS Model Number:YSCP Place of Origin:China Product Information Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also know as AC 2993, Bydureon, ... |
Chengdu YoungShe Chemical Co.,Ltd
Sichuan |
Place of Origin:China Brand Name:RARE Trioctylamine CAS: 1116-76-3 Purity: 98% Min. Appearance: Colorless or yellowish transparent oily liquid Shu amine: 3.3% Min. Total amine: 3.4% Min. Acid value mgKOH/g: 128-142 Water content: 0.5% Max. Color APHA: 80 Max. Application: It can be used as ... |
Rare Mine Chemical Resources Limited
Hongkong |
Place of Origin:china mainland Model Number:SCE-C06 Brand Name:close Item Specification Results Appearance : White crystalline powder Assay: 99.7% Melting point: 198.5~201.5℃ Clarity of water solution: Transparency, colorless pH value of 1% aqueous solution: 5.0~7.0 Specific optical rotation 【α】 D 20 =-66±2º : -65.3 Arsenic... |
SUN CHEM ENTERPRISE CO., LTD
Zhejiang |
Brand Name:Zorui Model Number:111-29-5 Place of Origin:China ISO Factory 1,5-Pentanediol/ PDO/ 1,5-PDO CAS 111-29-5 Product Description Name :1, 5-pentanediol Molecular formula :C₅H12O₂ CAS number :111-29-5 Application :Used as a solvent for cutting oils, special detergents, latex paints, ink solvents or wetting ... |
Shanxi Zorui Biotechnology Co., Ltd.
Shanxi |
Brand Name:CHUYAN Model Number:CAS 608137-33-3 Place of Origin:China Main Products BMK PMK CAS 20320-59-6 BMK oil CAS 5413-05-8 BMK powder CAS 5449-12-7 BMK Glycidic Acid CAS 28578-16-7 PMK ethyl glycidate oil/powder Bromine CAS 1451-82-7 2-bromo-4-methylpropiophenone CAS 1451-83-8 2-bromo-3-methylpropiophenone CAS 236117-... |
Hanhong Medicine Technology (Hubei) Co., Ltd.
|
Place of Origin:Zhejiang, China Brand Name:Chemfine Model Number:Pigment red 170 ... Moisture 1.0% max Residue passing through (80 mesh) 5.0% max Soluble matter in water 1.5% max Conductivity 500 max Application of CAS NO.2786-76-7 Pigment red 170 : Main Application: Air Drying Paint, Offset Ink Can Use: Industrial Paint, |
Chemfine International Co., Ltd.
Jiangsu |
Brand Name:Ceres Place of Origin:Shaanxi, China Factory supply Cas :111-17-1 Galacto-oligosaccharides Product Name Factory supply Cas :111-17-1 Galacto-oligosaccharides Appearance White Powder Shelf Life 2 Years Test Method HPLC/UV Function Food ... |
Ceres Biotech Co., Ltd
|
Brand Name:AJA Place of Origin:Anhui China ... power Assay: 99% min Product name: 4-Methoxyphenol Molecular formula : C7H8O2 CAS NO. : 150-76-5 Molecular weight: 124.14 Quality Index : Appearance white crystal Melting point 54.0~56.5℃ Assay≥ 99.5% ... |
Anhui Jin'ao Chemical Co., Ltd.
Anhui |
Brand Name:Senlong-MOTOR Model Number:John Deere tractor Place of Origin:Guangzhou China 24V 45A Alternator For John Deere CAS-E Excavator tractor Cummins Industrial Engine 3020678 DELCO 19020536 Specifiions: Item Condition Aftermarket Part Unit Type Alternator Voltage 24 Rotation BI Amperage 45 Regulator IR Material 100% Copper, Electronic ... |
Guangzhou Senlong Machinery Equipment Co., Ltd.
Guangdong |
Brand Name:AK BIOTECH Model Number:Fmoc-(2R,3S)-AHPA Place of Origin:CHINA Fmoc-(2R,3S)-AHPA CAS No 654060-49-8 for the impurities of ubenimex White powder Purity 98% Name: Fmoc-(2R,3S)-AHPA CAS No: 654060-49-8 M.W: 417.46 Appearance: White powder Purity: 98% Product No: AK0022 Synonyms: (2R,3S)-3-(9-Fluorenylmethoxy carbonyl)-... |
AK Biotech Co.,Ltd
Sichuan |
Brand Name:DEM Model Number:Ford 6Y/7A Place of Origin:Zhejiang For Ford Piston Ring 6Y/7A 111.76mm 2.38+2.38+ 2.38+4.76 Anti-Friction Model For Ford Piston Ring 6Y/7A 111.76mm 2.38+2.38+ 2.38+4.76 Anti-Friction DIA. 111.76mm SIZE 2.38+2.38+ 2.38+4.76 Application PISTON RING Quality ISO 9001:2008 ISO/TS16949 standard ... |
PingYang DEM Auto Parts Factory
Zhejiang |
Brand Name:WATSON Model Number:WPS-CA Plunger Place of Origin:China Solenoid Valve Plunger WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD Pulse Jet Valve Technical Specifications: (1). Working Pressure: 4-6 bar; (2). Working medium: clean air (3). Power supply: DC24V (AC220V/50Hz- 240V/60Hz) (4). Class of protection: IP65; (5). ... |
Ningbo Fly Automation Co.,Ltd
Zhejiang |
Brand Name:Wuxi Further Pharmaceutical Model Number:Food grade Place of Origin:China CAS 111-58-0 OEA Food additives Oleoyl Ethanolamide N-(2-hydroxyethyl)-,(Z)-9-Octadecenamid 98% OEA ODA Description: OEA is one of the long chain ... |
Wuxi Further Pharmaceutical Co., LTD
Jiangsu |
Brand Name:Aweier Model Number:111-62-6 Place of Origin:China High quality and best price colorless liquid Ethyl oleate CAS 111-62-6 Large quantity in stock product Description Ethyl oleate is a colorless oily liquid at room temperature and pressure, with a significant aroma. It is insoluble in water, but soluble in ... |
Guangzhou Aweier New Material Technology Co., LTD
|