Sign In | Join Free | My chinalane.org
chinalane.org
Products
Search by Category

cas no 111 76 2

All cas no 111 76 2 wholesalers & cas no 111 76 2 manufacturers come from members. We doesn't provide cas no 111 76 2 products or service, please contact them directly and verify their companies info carefully.

Total 1196 products from cas no 111 76 2 Manufactures & Suppliers
Wholesale Large Size T441 Thrust Tapered Roller Bearing 111.76*223.52*55.88mm Brass Cage from china suppliers

Brand Name:TIMKEN / NSK / NTN / FSKG / KBE / OEM

Model Number:T441

Place of Origin:CHINA

...111.76*223.52*55.88mm Brass Cage Bearing Specification : FSK BEARING Model Number T441 Part Name Thrust Tapered Roller Bearing Application Tower Crane/Rolling Mill/Oil Drilling Material Gcr15 Chrome steel Cage Brass Cage Row Single Row Brand TIMKEN / NSK / NTN / FSKG / KBE / OEM Precision Rating ABEC-3 / ABEC-5 Dimensions(mm)(d*D*b) 111.76...

Wuxi FSK Transmission Bearing Co., Ltd
Verified Supplier

Jiangsu

Wholesale Raspberry ketone CAS No.: 84929-76-0 from china suppliers

Place of Origin:China

Brand Name:Chinafoodpharm

Raspberry ketone CAS No.: 84929-76-0 Appearance: white powder Variety: raspberry extract Extract Method: Water/ Grain Alcohol Specification:99% ABOUT Raspberry Ketones: ...

China Foodpharm Group Co., Ltd
Active Member

Anhui

Wholesale Arbutin;CAS NO.: 497-76-7;98% from china suppliers

Brand Name:Zhanjo

Model Number:ZJ-257

Place of Origin:China

English name]: Arbutin [CAS NO.]: 497-76-7 [Formula]: C12H16O7 [Molecular Weight]: 272.25 [Structural Formula]: [Specification]: 98% [Test method]: HPLC [Product properties]: ...

Anhui Zhanjo Natural Product Co.,ltd
Site Member

Anhui

Wholesale (CAS No.:82161-76-0)INDENYLZIRCONIUM(IV) TRICHLORIDE from china suppliers

Brand Name:Honorshine Chem

Place of Origin:China WuXi

INDENYLZIRCONIUM(IV) TRICHLORIDE Product code:INDENYLZIRCONIUM(IV) TRICHLORIDE CAS No.:82161-76-0 Molecular formula: C9H7Cl3Zr Molecular Weight: 312.73 Materialized properties: Melting Point: 151-161°c In Stock : Available / Available on request Supply ...

WUXI HONOR SHINE CHEMICAL CO.,LTD
Active Member

Jiangsu

Wholesale CAS No. 497-76-7 Beta Arbutin with 99% Purity for Skin Whiten Cosmetic Products from china suppliers

Brand Name:BBP

Model Number:BBP-ARBUTIN-01

Place of Origin:CHINA

CAS No. 497-76-7 Beta Arbutin with 99% Purity for Skin Whiten Cosmetic Products Beyond Bionherbal is a professional manufacturer and supplier of Beta Arbutin. The appearance of Beta Arbutin is white crystal Powder and it is Easily soluble in hot water and ...

Beyond Bioherbal Co.,ltd.
Site Member

Shanghai

Wholesale Olopatadine hydrochloride,Olopatadine( CAS NO.:140462-76-6) from china suppliers

Brand Name:Olopatadine hydrochloride

Model Number:CAS NO.:140462-76-6

Place of Origin:.

Name :Olopatadine hydrochloride Synonyms :(Z)-11-[3-(Dimethylamino)propylidene]-6,11-dihydrodibenz[b,e]oxepin-2-acetic acid hydrochloride Molecular Formula : C21H23NO3.HCl Molecular Weight :373.88 CAS NO.: 140462-76-6

Suzhou Howsine Biological Technology Co.,Ltd
Site Member

Jiangsu

Wholesale Exenatide Acetate Cas No:141732-76-5 from china suppliers

Brand Name:YS

Model Number:YSCP

Place of Origin:China

Product Information Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: synthetic Also know as AC 2993, Bydureon, ...

Chengdu YoungShe Chemical Co.,Ltd
Site Member

Sichuan

Wholesale Extracting agent TOA Trioctylamine factory price/Tri-octylamine Cas No.1116-76-3 Trioctylamine from china suppliers

Place of Origin:China

Brand Name:RARE

Trioctylamine CAS: 1116-76-3 Purity: 98% Min. Appearance: Colorless or yellowish transparent oily liquid Shu amine: 3.3% Min. Total amine: 3.4% Min. Acid value mgKOH/g: 128-142 Water content: 0.5% Max. Color APHA: 80 Max. Application: It can be used as ...

Rare Mine Chemical Resources Limited
Active Member

Hongkong

Wholesale β - Arbutin CAS NO.497-76-7<cosmetic grade> from china suppliers

Place of Origin:china mainland

Model Number:SCE-C06

Brand Name:close

Item Specification Results Appearance : White crystalline powder Assay: 99.7% Melting point: 198.5~201.5℃ Clarity of water solution: Transparency, colorless pH value of 1% aqueous solution: 5.0~7.0 Specific optical rotation 【α】 D 20 =-66±2º : -65.3 Arsenic...

SUN CHEM ENTERPRISE CO., LTD
Site Member

Zhejiang

Wholesale ISO Industrial Grade Chemicals 1 5-Pentanediol / PDO CAS 111-29-5 from china suppliers

Brand Name:Zorui

Model Number:111-29-5

Place of Origin:China

ISO Factory 1,5-Pentanediol/ PDO/ 1,5-PDO CAS 111-29-5 Product Description Name :1, 5-pentanediol Molecular formula :C₅H12O₂ CAS number :111-29-5 Application :Used as a solvent for cutting oils, special detergents, latex paints, ink solvents or wetting ...

Shanxi Zorui Biotechnology Co., Ltd.
Verified Supplier

Shanxi

Wholesale 99% Purity CAS 608137-33-3 (2S)-2,6-DIAMINO-N-[(1S)-1-METHYL-2-PHENYLETHYL]HEXANAMIDE DIMETHANESULFONATE Supply from china suppliers

Brand Name:CHUYAN

Model Number:CAS 608137-33-3

Place of Origin:China

Main Products BMK PMK CAS 20320-59-6 BMK oil CAS 5413-05-8 BMK powder CAS 5449-12-7 BMK Glycidic Acid CAS 28578-16-7 PMK ethyl glycidate oil/powder Bromine CAS 1451-82-7 2-bromo-4-methylpropiophenone CAS 1451-83-8 2-bromo-3-methylpropiophenone CAS 236117-...

Hanhong Medicine Technology (Hubei) Co., Ltd.
Verified Supplier

Wholesale Ci Pigment Red 170 Cas 2786-76-7 Plastic Rubber Pigment Ink Paint Chemical Pigment from china suppliers

Place of Origin:Zhejiang, China

Brand Name:Chemfine

Model Number:Pigment red 170

... Moisture 1.0% max Residue passing through (80 mesh) 5.0% max Soluble matter in water 1.5% max Conductivity 500 max Application of CAS NO.2786-76-7 Pigment red 170 : Main Application: Air Drying Paint, Offset Ink Can Use: Industrial Paint,

Chemfine International Co., Ltd.
Verified Supplier

Jiangsu

Wholesale Cas 111-17-1 Galacto Oligosaccharides For Food Industry from china suppliers

Brand Name:Ceres

Place of Origin:Shaanxi, China

Factory supply Cas :111-17-1 Galacto-oligosaccharides Product Name Factory supply Cas :111-17-1 Galacto-oligosaccharides Appearance White Powder Shelf Life 2 Years Test Method HPLC/UV Function Food ...

Ceres Biotech Co., Ltd
Verified Supplier

Wholesale MEHQ Organic Reaction Intermediates 150-76-5 CAS , 4 Methoxyphenol For Pastic from china suppliers

Brand Name:AJA

Place of Origin:Anhui China

... power Assay: 99% min Product name: 4-Methoxyphenol Molecular formula : C7H8O2 CAS NO. : 150-76-5 Molecular weight: 124.14 Quality Index : Appearance white crystal Melting point 54.0~56.5℃ Assay≥ 99.5% ...

Anhui Jin'ao Chemical Co., Ltd.
Verified Supplier

Anhui

Wholesale 24V 45A  Alternator For John Deere CAS-E Excavator tractor  Cummins  Industrial Engine 3020678  DELCO  19020536 from china suppliers

Brand Name:Senlong-MOTOR

Model Number:John Deere tractor

Place of Origin:Guangzhou China

24V 45A Alternator For John Deere CAS-E Excavator tractor Cummins Industrial Engine 3020678 DELCO 19020536 Specifiions: Item Condition Aftermarket Part Unit Type Alternator Voltage 24 Rotation BI Amperage 45 Regulator IR Material 100% Copper, Electronic ...

Guangzhou Senlong Machinery Equipment Co., Ltd.
Verified Supplier

Guangdong

Wholesale APIs Intermediates Fmoc-(2R,3S)-AHPA CAS No 654060-49-8 For The Impurities Of Ubenimex White Powder Purity  98% from china suppliers

Brand Name:AK BIOTECH

Model Number:Fmoc-(2R,3S)-AHPA

Place of Origin:CHINA

Fmoc-(2R,3S)-AHPA CAS No 654060-49-8 for the impurities of ubenimex White powder Purity 98% Name: Fmoc-(2R,3S)-AHPA CAS No: 654060-49-8 M.W: 417.46 Appearance: White powder Purity: 98% Product No: AK0022 Synonyms: (2R,3S)-3-(9-Fluorenylmethoxy carbonyl)-...

AK Biotech Co.,Ltd
Verified Supplier

Sichuan

Wholesale For Ford Piston Ring 6Y/7A 111.76mm 2.38+2.38+ 2.38+4.76 Anti-Friction from china suppliers

Brand Name:DEM

Model Number:Ford 6Y/7A

Place of Origin:Zhejiang

For Ford Piston Ring 6Y/7A 111.76mm 2.38+2.38+ 2.38+4.76 Anti-Friction Model For Ford Piston Ring 6Y/7A 111.76mm 2.38+2.38+ 2.38+4.76 Anti-Friction DIA. 111.76mm SIZE 2.38+2.38+ 2.38+4.76 Application PISTON RING Quality ISO 9001:2008 ISO/TS16949 standard ...

PingYang DEM Auto Parts Factory
Verified Supplier

Zhejiang

Wholesale Solenoid Valve Plunger Pulse Jet Valves WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD from china suppliers

Brand Name:WATSON

Model Number:WPS-CA Plunger

Place of Origin:China

Solenoid Valve Plunger WATSON WPS-CA/EP WPS-CA/TG WPS-CA/TD Pulse Jet Valve Technical Specifications: (1). Working Pressure: 4-6 bar; (2). Working medium: clean air (3). Power supply: DC24V (AC220V/50Hz- 240V/60Hz) (4). Class of protection: IP65; (5). ...

Ningbo Fly Automation Co.,Ltd
Verified Supplier

Zhejiang

Wholesale CAS 111-58-0  OEA  Food Additives  Oleoyl Ethanolamide  N-(2-Hydroxyethyl)-,(Z)-9-Octadecenamid 98%  OEA ODA from china suppliers

Brand Name:Wuxi Further Pharmaceutical

Model Number:Food grade

Place of Origin:China

CAS 111-58-0 OEA Food additives Oleoyl Ethanolamide N-(2-hydroxyethyl)-,(Z)-9-Octadecenamid 98% OEA ODA Description: OEA is one of the long chain ...

Wuxi Further Pharmaceutical Co., LTD
Verified Supplier

Jiangsu

Wholesale High quality and  best  price  colorless liquid  Ethyl oleate  CAS 111-62-6 Large quantity in stock from china suppliers

Brand Name:Aweier

Model Number:111-62-6

Place of Origin:China

High quality and best price colorless liquid Ethyl oleate CAS 111-62-6 Large quantity in stock product Description Ethyl oleate is a colorless oily liquid at room temperature and pressure, with a significant aroma. It is insoluble in water, but soluble in ...

Guangzhou Aweier New Material Technology Co., LTD
Verified Supplier

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request