Sign In | Join Free | My chinalane.org
chinalane.org
Products
Search by Category
Home > Chemicals > Chemical Machinery Parts >

Sermorelin Before And After

sermorelin before and after

All sermorelin before and after wholesalers & sermorelin before and after manufacturers come from members. We doesn't provide sermorelin before and after products or service, please contact them directly and verify their companies info carefully.

Total 9979 products from sermorelin before and after Manufactures & Suppliers
Wholesale Sermorelin Peptides Injectable 86168-78-7 Human Growth Hormone Releasing Peptides from china suppliers

Brand Name:Hongkong SaiChuang

Model Number:86168-78-7

Place of Origin:China

...Sermorelin Peptides for Muscle Gaining Injectable 86168-78-7 Sermorelin No.: 86168-78-7 Molecular Formula: C149H246N44O42S Molecular Weight: 3357.96 Purity (HPLC): 99.0%min. Single ...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Wholesale White Powder Sermorelin Human Growth Hormone Peptide Bodybuilding 86168-78-7 from china suppliers

Brand Name:Pharmlab

Model Number:86168-78-7

Place of Origin:China

...99% Pharmaceutical Raw Materials White Powder Sermorelin Peptide Hormones Bodybuilding 86168-78-7 Quick Detail : Product Name Sermorelin Synonym Somatoliberin,Sermorelin CAS NO 86168-78-7 Molecular Formula C149H246N44O42S Molecular weight 3357.96 Purity 98...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Wholesale Growth hormone Peptide Powder 2mg/vial Sermorelin GRF 1-29 CAS 86168-78-7 from china suppliers

Brand Name:YIHAN

Model Number:Sermorelin--GRF(1-29)

Place of Origin:China

...Growth hormone Peptide Powder 2mg/vial Sermorelin GRF 1-29 CAS 86168-78-7 Quick Detail: Product Name Sermorelin Chemical Name Sermorelin Acetate,GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Wholesale Sermorelin GRF 1-29 Muscle Buidling Steroids CAS 804475-66-9 White Lyophilized Powder from china suppliers

Brand Name:HKYC

Model Number:218949-48-5

Place of Origin:China

Product Name: Tesamorelin Molecular Formula: C221H366N72O67S Molecular Weight: 5135.77794 PubChem: CID 44201342 Synonyms: Hex-hGRF, ThGRF(1-44), TH-9507, (Hexenoyl trans-3)-hGRF(1-44)-NH2 Sequence (Three-Letter Code): trans-3-hexenoyl-Tyr-Ala-Asp-Ala-Ile-...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Wholesale LGRF 1-29 Sermorelin Acetate Peptides For Fat Loss And Muscle Gain CAS 86168-78-7 from china suppliers

Brand Name:YUANHANG

Model Number:86168-78-7

Place of Origin:CHINA

...Peptide Hormones Sermorelin 2mg/vial GRF 1-29 CAS 86168-78-7 For Weight Loss Sermorelin Acetate Sermorelin Properties alpha D20 -63.1° (c = 1 in 30% acetic acid) storage temp. −20°C Abstract Sermorelin (INN) (trade name is...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Wholesale Sermorelin Acetate Muscle Building Peptides Sermorelin CAS 86168-78-7 GRF 1-29 High Purity from china suppliers

Brand Name:TINGYI

Model Number:86168-78-7

Place of Origin:China

...Sermorelin Acetate 2 mg/vial Muscle Gaining Peptides Sermorelin CAS 86168-78-7 GRF 1-29 High Purity Abstract Sermorelin, also known as GRF 1-29, is a synthetic peptide belonging to Hormone Releasing Hormone. Sermorelin Acetate is a truncated...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Wholesale 2mg 5mg/Vial Bodybuilding Peptides , Bulking Cycle Polypeptide Sermorelin from china suppliers

Brand Name:Filter

Model Number:86168-78-7

Place of Origin:China

...Sermorelin 2mg/5mg Vial Sermorelin for Bulking Cycle CAS: 86168-78-7 Polypeptide Sermorelin 2mg/5mg Vial Sermorelin for Bulking Cycle CAS: 86168-78-7 Product Description Polypeptide Sermorelin 2mg 5mg Vial Sermorelin for Bulking Cycle Sermorelin Sermorelin...

Passion Technology Development Limited
Verified Supplier

Henan

Wholesale White Powder Releasing Human Growth Peptides Sermorelin Acetate GRF 1-29 from china suppliers

Brand Name:Yuancheng

Model Number:86168-78-7

Place of Origin:WUHAN

... Peptide Sermorelin Acetate GRF 1-29 Product Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Wholesale Lyophilized Powder Sermorelin 2mg for Body Building CAS 86168-78-7 from china suppliers

Brand Name:YIHAN

Model Number:Sermorelin 2mg

Place of Origin:CHINA

...Lyophilized Powder Sermorelin 2mg for Body Building CAS 86168-78-7 Quick detail: Product Name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GROWTH HOR RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Wholesale Sermorelin Acetate Muscle Building Growth Hormone In Humans Peptides Sermorelin CAS 86168-78-7 GRF 1-29 from china suppliers

Brand Name:SGH

Model Number:86168-78-7

Place of Origin:China

...- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Wholesale Bodybuilding Peptides Human Growth Hormones Sermorelin For Fat Loss from china suppliers

Brand Name:shanghai stero

Model Number:86168-78-7

Place of Origin:china

... days Payment:money gram,western union,T/T,bitcoin,etc. Manufacturer:Shanghai Stero R&D Co., ltd What is sermorelin? 1. Sermorelin (GHRH) is a recently developed bioequivalent hormone that stimulates growth hormone releasing hormone

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Wholesale 99% High Purity Peptide Hormone Sermorelin for Improving Sleep and Muscle Building from china suppliers

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Wholesale Sell Top Quality Muscle Growth Peptides Sermorelin Lyophilized Powder from china suppliers

Brand Name:Kafen

Place of Origin:China

...:99% Min China Manufacturer:Sermorelin Payment:Western Union, Money Gram, T/T, Bitcoin Shipment:Hkems, EMS, FedEx, TNT, DHL, UPS, Aramex 2.Product Description: Sermorelin is a grow steroid releasing hormone analogue. Sermorelin is a 29-amino acid...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Wholesale Polypeptide Recombinant Human Growth Hormone Sermorelin for Increase Lean Body Mass from china suppliers

Brand Name:GC

Model Number:86168-78-7

Place of Origin:China

... Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate 2. Description: Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid

Shenzhen Keray Biotech Co., Ltd
Verified Supplier

Guangdong

Wholesale Injection Muscle Building Human Peptides Lyophilized Powder Sermorelin 2mg from china suppliers

Brand Name:HKB

Model Number:86168-78-7

Place of Origin:China

...Injection Muscle Building Human Peptides Lyophilized Powder Sermorelin 2mg Detail: Product Name: Sermorelin Synonyms: Sermorelin acetate, GRF 1-29 CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.88 Usage xanthine oxidase inhibitor ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Wholesale 86168-78-7 Weight Loss Steroids Sermorelin for Increase Lean Body Mass from china suppliers

Brand Name:Simeiquan

Model Number:86168-78-7

Place of Origin:China

...86168-78-7 Weight Loss Steroids Sermorelin for Increase Lean Body Mass Sermorelin Acetate/Cas No.: 86168-78-7 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-...

Shenzhen Haiwen Biotechnology Co.,Ltd
Verified Supplier

Guangdong

Wholesale Safety Growth Hormone Peptides Sermorelin 2mg For Build Muscle from china suppliers

Brand Name:BestSteroid

Model Number:86168-78-7

Place of Origin:Hubei,China

...Safety Growth Hormone Peptides Sermorelin 2mg For Bodybuilding Sermorelin Basic Info Name: Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Peptide purity: > 98.0% Appearance: White lyophilized powder Related ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Wholesale Sermorelin Acetate Human Growth Hormone Anti Aging CAS 86168-78-7 For Adults from china suppliers

Brand Name:ORIPHARM

Model Number:XALY

Place of Origin:China

... Growth Human Peptides for Anti Aging CAS 86168-78-7 Product Name Sermorelin Acetate CAS No. 86168-78-7 Synonyms Sermorelina; Sermorelinum; Sermoreline Molecular Formula C149H246N44O42S Molecular Weight 3357.882 g·mol−1 Structure Purity...

Xi'an Oripharm Technology Co.,Ltd
Verified Supplier

Shaanxi

Wholesale High Effective Peptide Hormone Sermorelin Acetate For Muscle Building CAS 86168-78-7 from china suppliers

Brand Name:bodybiological

Model Number:CAS 86168-78-7

Place of Origin:Hubei, China

... first 29 amino acids is actually what is responsible for stimulating pituitary response. The name Sermorelin is the prescription drug name and this alone is why it is so widely prescribed...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Wholesale Growth hormone–releasing hormone 2mg/vial Sermorelin CAS 86168-78-7 Changes in Body Composition from china suppliers

Brand Name:hksteroids.net

Model Number:86168-78-7

Place of Origin:China

... Composition 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO.86168-78-7 Synonyms Sermorelin Molecular Formula C149H246N44O42S Molecular Weight 3357.96 Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request