Sign In | Join Free | My chinalane.org
chinalane.org
Products
Search by Category
Home > Chemicals > Agrochemicals >

Sermorelin Before And After

sermorelin before and after

All sermorelin before and after wholesalers & sermorelin before and after manufacturers come from members. We doesn't provide sermorelin before and after products or service, please contact them directly and verify their companies info carefully.

Total 9318 products from sermorelin before and after Manufactures & Suppliers
Wholesale Sermorelin 86168-78-7 Bodybuilding Peptide 99% Purity USP Standard Quick Effect from china suppliers

Brand Name:TINGYI

Model Number:86168-78-7

Place of Origin:China

...Detail Product Name Sermorelin Synonym Somatoliberin,Sermorelin CAS NO. 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.96 Molecular Structure Purity 99% ...

Chongqing Tingyi Biotechnology Co.,Ltd
Verified Supplier

Chongqing

Wholesale Body Protection Compound-157 Pentadecapeptide Bpc-157/Tb-500/Sermorelin from china suppliers

Brand Name:Simeiquan

Model Number:23423

Place of Origin:China

Body Protection Compound-157 Pentadecapeptide Bpc-157 BPC 157 (Body Protection Compound-157) is a pentadecapeptide made up of 15 amino acids. The amino acids sequence in BPC 157 is similar to a portion of the human BPC amino acid sequence. Human BPC is ...

Wuhan Hezhong Bio-Chemical Manufacture Co., Ltd.
Verified Supplier

Hubei

Wholesale Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate from china suppliers

Brand Name:YIHAN

Model Number:Sermorelin

Place of Origin:hina

... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Wholesale 99% Purity Anti - aging Bulking Cycle Human Peptides Sermorelin Acetate for Muscle Gainning from china suppliers

Brand Name:Pharm

Model Number:86168-78-7

Place of Origin:China

...99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate for Muscle Gainning Quick detail Product name: Sermorelin CAS: 86168-78-7 Appearance: white lyophilized powder MF: C149h246n44o42s MW: 3357.88 purity: 99...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Wholesale GHRP-2 Sermorelin Lyophilized Inject To Promote Children Grow Taller MGF MT-1 from china suppliers

Brand Name:SMQ

Model Number:Sermorelin

Place of Origin:China mainland

...Sermorelin Lyophilized Inject To Promote Children Grow Taller Detailed Product Description Product Name: Sermorelin Appearance: Lyophilized powder CAS NO.: 86168-78-7 Purity: 99% Alias: Sermorelin Application: Peptide Drum Quick Detail: Sermorelin Acetate ...

Shenzhen Haiwen Biotechnology Co.,Ltd
Verified Supplier

Guangdong

Wholesale Injection Muscle Building Human Peptides Lyophilized Powder Sermorelin 2mg from china suppliers

Brand Name:HKB

Model Number:86168-78-7

Place of Origin:China

...Injection Muscle Building Human Peptides Lyophilized Powder Sermorelin 2mg Detail: Product Name: Sermorelin Synonyms: Sermorelin acetate, GRF 1-29 CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.88 Usage xanthine oxidase inhibitor ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Wholesale Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available from china suppliers

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Wholesale Sermorelin Acetate Growth Hormone Steroids Bio Peptide HGH  86168-78-7 from china suppliers

Brand Name:Steroid(Saichuang)

Model Number:99

Place of Origin:China

... Growth Hormone Steroids Bio Peptide HGH 86168-78-7 Basic information Sermorelin Sermorelin Specification:2mg*10vials/kit Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Wholesale 2mg 5mg/Vial Bodybuilding Peptides , Bulking Cycle Polypeptide Sermorelin from china suppliers

Brand Name:Filter

Model Number:86168-78-7

Place of Origin:China

...Sermorelin 2mg/5mg Vial Sermorelin for Bulking Cycle CAS: 86168-78-7 Polypeptide Sermorelin 2mg/5mg Vial Sermorelin for Bulking Cycle CAS: 86168-78-7 Product Description Polypeptide Sermorelin 2mg 5mg Vial Sermorelin for Bulking Cycle Sermorelin Sermorelin...

Passion Technology Development Limited
Verified Supplier

Henan

Wholesale Sermorelin Acetate Peptides Muscle Growth Peptides CAS 86168-78-7 For Building Muscle from china suppliers

Brand Name:Saichuang

Model Number:86168-78-7

Place of Origin:China

... Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity (HPLC): 98.0%min. Sermorelin Appearance...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Wholesale Lyophilized Powder Sermorelin 2mg for Body Building CAS 86168-78-7 from china suppliers

Brand Name:YIHAN

Model Number:Sermorelin 2mg

Place of Origin:CHINA

...Lyophilized Powder Sermorelin 2mg for Body Building CAS 86168-78-7 Quick detail: Product Name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GROWTH HOR RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78...

Yihan Industrial Co.,Ltd.
Verified Supplier

Guangdong

Wholesale Sermorelin Acetate Muscle Building Growth Hormone In Humans Peptides Sermorelin CAS 86168-78-7 GRF 1-29 from china suppliers

Brand Name:SGH

Model Number:86168-78-7

Place of Origin:China

...- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino...

Jiangsu Biostronger Technology Co.,Ltd
Verified Supplier

Jiangsu

Wholesale Safety Growth Hormone Peptides Sermorelin 2mg For Build Muscle from china suppliers

Brand Name:BestSteroid

Model Number:86168-78-7

Place of Origin:Hubei,China

...Safety Growth Hormone Peptides Sermorelin 2mg For Bodybuilding Sermorelin Basic Info Name: Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Peptide purity: > 98.0% Appearance: White lyophilized powder Related ...

Hubei Yuancheng Saichuang Technology Co., Ltd.
Verified Supplier

Hubei

Wholesale Sermorelin CAS 86168-78-7 Muscle Building Sterods Growth Hormone Releasing Hormones from china suppliers

Brand Name:Keray

Model Number:86168-78-7

Place of Origin:China

... Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate Product Name: Sermorelin Unit size: 2 mg/vial CAS NO.: 86168-78-7 Synonyms: GRF 1-29...

Shenzhen Keray Biotech Co., Ltd
Verified Supplier

Guangdong

Wholesale CAS 86168-78-7 Growth Hormone Peptides Somatropin Sermorelin Lyophilized Peptide Powder from china suppliers

Brand Name:Kafen

Model Number:86168-78-7

Place of Origin:China

...Description: Alias: GRF 1-29 NH2, Sermorelin Acetate Hydrate CAS: 86168-78-7 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Wholesale Muscle Bodybuilding Sermorelin Acetate 2mg Repair Of Injury from china suppliers

Brand Name:Bodybiolgical

Model Number:Sermorelin

Place of Origin:Hubei, China

...Repair of Injury Sermorelin Acetate 2mg for Muscle Bodybuilding Detailed information: Sermorelin acetate is a synthetic analog of naturally occurring Growth Hormone-Releasing Hormone (GHRH). GHRH is produced ...

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Wholesale Sermorelin Acetate Human Growth Hormone Anti Aging CAS 86168-78-7 For Adults from china suppliers

Brand Name:ORIPHARM

Model Number:XALY

Place of Origin:China

... Growth Human Peptides for Anti Aging CAS 86168-78-7 Product Name Sermorelin Acetate CAS No. 86168-78-7 Synonyms Sermorelina; Sermorelinum; Sermoreline Molecular Formula C149H246N44O42S Molecular Weight 3357.882 g·mol−1 Structure Purity...

Xi'an Oripharm Technology Co.,Ltd
Verified Supplier

Shaanxi

Wholesale CAS86168-78-7 Human Growth Peptides Sermorelin Bodybuilding For Muscle Growth from china suppliers

Brand Name:Pharma Grade

Model Number:86168-78-7

Place of Origin:Zhejiang,China

...Sermorelin CAS86168-78-7 human growth Peptides for Muscle growth Polypeptides are compounds in which alpha-amino ...

HONGKONG RONGXIN BIO-TECH CO.,LTD
Verified Supplier

Shaanxi

Wholesale Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 from china suppliers

Model Number:99%

Place of Origin:China

...Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Wholesale GHRH Sermorelin Bodybuilding Human Growth Hormone Anabolic Steroid 86168-78-7 from china suppliers

Brand Name:GB

Place of Origin:China

... MF C149H246N44O42S MW 3357.88 Alias GRF 1-29 NH2, Sermorelin Acetate Hydrate Storage −20°C Usage Muscle Gain or get taller Origin China Sermorelin Description : 1. Sermorelin(GHRH) is a bio-identical hormone that has recently...

Hubei God bull Pharmaceutical Co.,Ltd
Site Member

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request