Sign In | Join Free | My chinalane.org
chinalane.org
Products
Search by Category
Home > Measurement & Analysis Instruments >

Measuring & Analysing Instrument Design Services

Measuring & Analysing Instrument Design Services

All Measuring & Analysing Instrument Design Services wholesalers & Measuring & Analysing Instrument Design Services manufacturers come from members. We doesn't provide Measuring & Analysing Instrument Design Services products or service, please contact them directly and verify their companies info carefully.

Total 3400 products from Measuring & Analysing Instrument Design Services Manufactures & Suppliers
Wholesale Ultrasonic Plastic Welding Machine Plastic Plugs Electronic Parts Welding from china suppliers

Brand Name:Youwoly

Model Number:YW-S3510

Place of Origin:China

Product Description Specifications Model YW-1532 YW-1542 Frequency 15KHZ Power 3200W 4200W Max Stroke 75mm-125mm Welding Time 0.01-9.99sec Welding Area φ220 φ250 Dimensions L900mm*W780mm*H2200mm Weight 160kg 220kg Main Functions: 1: Adopt IC full ...

Suzhou Youwoly Machinery Equipment CO.,LTD
Active Member

Jiangsu

Wholesale 234416 Double direction angular contact thrust ball bearings from china suppliers

Brand Name:DRZ

Model Number:234416

Place of Origin:China

Double-direction Angular Contact Thrust Ball Bearing DRZ double direction angular contact thrust ball bearing is a bearing unit composed of an integral outer ring, a group of sectile inner rings, steel balls, cage assemblies and sealing. It features ...

Luoyang De Run Precision Machine Tool Bearings Co., Ltd.
Active Member

Henan

Wholesale Toshiba TBA-30FR TBA-40FR TBA-120FR Halogen Lamp  12V 20W BSM10-1405 from china suppliers

Brand Name:Toshiba

Model Number:TBA-30FR TBA-40FR TBA-120FR

Place of Origin:China

Toshiba TBA-30FR TBA-40FR TBA-120FR Halogen Lamp 12V 20W BSM10-1405

Servilab Medical Corp., Ltd.
Site Member

Shandong

Wholesale FANN Instruments Viscometer Model 35A 207198 from china suppliers

Brand Name:FANN

Model Number:207198

Place of Origin:USA

Fann Instrument Company specializes in the design and manufacture of instrumentation for measuring the physical and chemical properties of various fluid properties and especially the measurement of flow and viscosity. Their product line is the most ...

Shenzhen PMZ Technology Inc.
Active Member

Wholesale Peptide synthesis  API powder ACTH(1-39) / Corticotropin CAS 9002-60-2 pharmaceutical intermediate from china suppliers

Brand Name:Youngshe Peptide

Model Number:CAS No: 9002-60-2

Place of Origin:China

ACTH(1-39) / Corticotropin 1.Basic information: Cas No: 9002-60-2 Formula: C207H308N56O58S Molecular: 4541.0658 Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF Purity: 98% Appearance: white powder Source: synthetic Also known as: Adrenocorticotropin, ...

Chengdu youngshe chemical Co,.Ltd
Active Member

Wholesale Power Voltage Converter AC 110V-220V to DC 0-48V Module Switching Power Supply Digital Display 100W Voltage Regulator from china suppliers

Brand Name:PR

Model Number:PR-A100

Place of Origin:China

Switching Power Supply _ PR-100 Series Two years warranty Built-in EMI filter 100% Load aging test Wide range of input voltage Accurate and stable output voltage Output over-voltage, over-current and short-circuit protection Low output ripple and noise ...

Power Real CO.,Limited
Site Member

Guangdong

Wholesale 5mm silver mirror  Waterproof Silver Mirror Glass, Double Coated with Italy Fenzi Paints from china suppliers

Brand Name:OBG

Model Number:customized

Place of Origin:Qingao

Silver mirror Specifications: Thickness 2 mm to 6 mm Size according to your design. Payment terms T/T 30% as deposited and balance should be send to us for as copy of Bill of loading. Min. Order: 100Pieces per Item Use: For bath mirror, decorative mirror ...

Qingdao Oriental Brother New Energy Technology Co., Ltd.
Active Member

Shandong

Wholesale 18K Luxury Gold Jewelry Love Necklace 18K Gold Love Ring Pendant with 2 Diamonds B7219500 from china suppliers

Place of Origin:China

Brand Name:18K Gold Luxury Jewelry

Model Number:B7219500

18K Luxury Gold Jewelry Love Necklace 18K Gold Love Ring Pendant with 2 Diamonds B7219500 SETTING Metal Type: 18K gold MAIN STONE Stone Type: Natural Diamonds Weight: Approx. 0.03ct Quantity: 2pcs Cut: round Color: F-G white Clarity: VVS/slightly defects ...

Shenzhen Jsely Jewelry Co., Ltd.
Site Member

Guangdong

Wholesale CONTEC MS100 SpO2 Simulator Patient Oximeter Simulator with DC Power from china suppliers

Place of Origin:China

Model Number:MS100

Brand Name:Contec

CONTEC MS100 SpO2 Simulator Patient Oximeter Simulator Brief Introduction MS100 SpO2 Simulator is a kind of Separated SpO2 simulator, small and light. It can perform a series of tests for the oximeter by simulation means, and gives cognizance of veracity ...

Shenzhen Huge Creation Technology Limited
Verified Supplier

Guangdong

Wholesale Long cycle life rechargeable lithium ion battery to storage solar energy 3.2V35Ah from china suppliers

Brand Name:HJY

Model Number:HJY-LFP26136181-35

Place of Origin:GUANGDONG CHINA

Max Discharging Rate Max Continuous Discharging:2C Max Peak Discharging:3C Cut-off Voltage Charging:3.65V Discharging:2.0V Internal Resistance ≤ 4mΩ (At 0.2C rate, 2.0V cut-off) Working Temperature Charging: 0℃~45℃ Discharging: -20℃~60℃ Storage...

Shenzhen HJY Technology Co. Ltd.
Site Member

Wholesale 134.2kHz Animal Ear Tag for Pig/Cow/Sheep from china suppliers

Place of Origin:GuangZhou

Brand Name:L-Link

Model Number:L-Link_AM01

the electronic ear tag is mainly used in livestock tracking and management, such as cows, dogs, pigs and other livestock. Normally it was installed onto the animals’ ear by a special animal ear tag pliers. The electronic ear tag uses non-toxic, no smell...

GuangZhou L-Link Technologies,Inc
Site Member

Guangdong

Wholesale Vertical Truss Tower for Moving Head from china suppliers

Brand Name:7Clighting

Model Number:7C-LS007

Place of Origin:CHINA

Product Description Product name : Vertical Truss Tower for Moving Head Product No. : 7C-LS007 Item: 7C-LS007 Height Optional: 1M / 1.5M / 2M Tube: Main tubes Φ50×2mm,Single connection bar Size (Top Plate): 350 x 350 x 8mm Size (Base Plate): 600 x 600 x...

Qicai Lighting Equipment Limited
Site Member

Guangdong

Wholesale AC 220 V 1 ph 3 Lines Cellphone Button Life Testing Machine For Industry from china suppliers

Brand Name:ASLi

Model Number:AS - 8330 C

Place of Origin:China

AS-8300C Button Life testing Machine.pdf Ce Certification Cellphone Button Life Testing Machine For Industry Used Application: Button life testing machine can do the keyboard life test of computer, cell phone, calculator and notepad. Features: 1 Can test ...

ASLi (CHINA) TEST EQUIPMENT CO., LTD
Verified Supplier

Wholesale Metal Mesh Curtain Fabrics Window Screen from china suppliers

Brand Name:YT

Model Number:YT1650

Place of Origin:Anping,Hebei,China

Quick Information Place of Origin:China Description This kind of metallic cloth is contact by many sequins(with 4 branches)and rings, it looks like a spider, each 'leg'of the sequin works in a ring and folded back itself to secure they connect each other....

Anping Yuntong Metal Wire Mesh Co., Ltd
Active Member

Wholesale Hardware accessories counting and packing machine, Hardware accessories pouch making machine from china suppliers

Brand Name:Bestar Packaging Machine

Model Number:Hardware accessories counting and packing machine

Place of Origin:Foshan ,China

New design Bestar Automatic Hardware accessories counting and packing machine, Hardware accessories pouch making machine,hardware accessories weighting and packing machine, hardware accessories packing machine, Hardware accessories packaging machine , ...

Bestar Packing Machine Co.Ltd
Site Member

Guangdong

Wholesale PC Carton Compression Tester, Package ,Corrugate Box ,Carton Compression Tester from china suppliers

Place of Origin:Guangdong, China (Mainland)

Brand Name:HAIDA

Model Number:HD-A502S-1500

PC Carton Compression Tester, Package ,Corrugate Box ,Carton Compression Tester Specifications Concrete Compressive Strength Tester Price 1.Motor:Import servo motor 2.Control system:Computer control Product introduce: PC Carton Compression Tester main for...

Dongguan Haida Equipment Co.,LTD
Verified Supplier

Guangdong

Wholesale big bag /open top jumbo bag 1500kg loading OEM Made in China from china suppliers

Brand Name:Hongye

Model Number:HY-FIBC-125

Place of Origin:China

Product Name PP woven bag/ Grain bag/ Fertilizer bag/ Chemical powder bag/ Sand sack Load capacity 500kg-2000kg Denier 350 to 1200 Regular size 85*85*90 cm 90*90*100cm 95*95*110cm as customer request GSM 40 GSM TO 250 GSM Top Top full open/Filling spout/ ...

Qinhuangdao Hongye Packing Products Co., Ltd.
Active Member

Hebei

Wholesale Intelligent Septic System Pump Control Panel from china suppliers

Brand Name:Leading

Model Number:L922-S

Place of Origin:CHINA

Intelligent Sewage Three Phase Water Pump Controller- Auto / Manual , One Button Calibration ,With LCD Displaying Product Brief: L922-S Sewage Pump controller ,is a smart and intelligent three phase fully automatic pump controller with built-in water ...

Hunan Leading Science and Technology Development Co.,Ltd
Verified Supplier

Hunan

Wholesale Button Force Testing Equipment 3 Points / 4 Points Bending Test Machine from china suppliers

Brand Name:Infinity Machine

Model Number:RS-6900H

Place of Origin:China

Button Force Testing Equipment 3 Points / 4 Points Bending Test Machine Model: RS-6900H Application: This servo control Multi-function tester is controlled by X,Y,Z axes, it is suitable for the button force test, the compression for electronic products, ...

Infinity Machine International Inc.
Verified Supplier

Guangdong

Wholesale Spot welding tip for enamelle wire welding from china suppliers

Brand Name:shouchuang

Place of Origin:China

Place of Origin: Guangdong, China (Mainland) Brand Name: shouchuang Model Number: customization Material: tungsten-molybdenum alloy Application: welding for electronic components life: 30-100k times Model: customization Payment: T/T Package: Carton ...

HeFei Zulr Trade Co.,Ltd
Active Member

Go to Page
Inquiry Cart 0